| 摘要 |
PROBLEM TO BE SOLVED: To primarily provide a novel antiviral drug, and to secondarily provide a novel antimicrobial agent.SOLUTION: By an agent containing, as an active ingredient, a peptide selected from the group consisting of the following (A) and (B), the above subject is solved; (A): a peptide consisting of an amino acid sequence represented by LNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYGSSFYYGKGLINV (sequence ID number 1), and (B) a peptide consisting of an amino acid sequence having deletion, substitution, or addition of one or several amino acids in the amino acid sequence (A), the peptide having antiviral activity.SELECTED DRAWING: Figure 3 |
