Novel Antibody And Use In Diagnosis And Therapy Of Arthropathies

摘要

The present invention provides a composition comprising an antibody or fragment thereof against oxidised Collagen II (CII) in which the antibody or fragment thereof is conjugated to a pharmaceutically active moiety. The invention also provides a composition comprising an antibody or fragment thereof against oxidised Collagen II (CII) and a detectable label. The invention further provides the use of such compositions in medicine, in particular for the treatment of an arthropathy, and in methods of diagnosis.

主权项

1. A composition comprising an antibody or fragment thereof against oxidised Collagen II (CII) in which the antibody or fragment thereof is conjugated to a pharmaceutically active moiety, wherein the antibody or fragment thereof comprises CDR sequences in the Variable Heavy (VH) chains and Variable Light (VL) chains as shown below, wherein the CDRH1 and CDRL1 sequences are the same as those of scFv 1-11E;CDRH2CDRH3CDRL2CDRL3SISNSGTNTDYADSVKGNYASFDYYASYLQSQQGSASPST(SEQ ID NO: 7)(SEQ ID NO: 45)(SEQ ID NO: 65)(SEQ ID NO: 92)SIASSGTTTYYADSVKGSYADFDYAASNLQSQQADTYPTT(SEQ ID NO: 31)(SEQ ID NO: 54)(SEQ ID NO: 82)(SEQ ID NO: 118)SIDSAGDSTYYADSVKGSYSYFDYTASYLQSQQASDYPTT(SEQ ID NO: 35)(SEQ ID NO: 58)(SEQ ID NO: 85)(SEQ ID NO: 122)SIDTGGSYTDYADSVKGSYTTFDYSASYLQSQQGSNSPTT(SEQ ID NO: 37)(SEQ ID NO: 59)(SEQ ID NO: 75)(SEQ ID NO: 124).