Biologically active tgf-beta 1 and tgf-beta 2 peptides

摘要

The invention relates to peptides corresponding to regions of the amino acid sequence of TGF- beta 1 or TGF- beta 2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF- beta . The monomeric form of the peptide derived from TGF- beta 1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF- beta 2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.