Allergen

摘要

An isolated horse allergen is disclosed which is a secretoglobin having a molecular weight of 15 kDa under non-reducing conditions and comprising a first peptide chain having a molecular weight of about 5 kDa and a second peptide chain having a molecular weight of about 10 kDa linked together, and variants and fragments thereof sharing epitopes for antibodies therewith. The use of the allergen in diagnosis and therapy is also disclosed as well as a diagnostic kit and a pharmaceutical composition containing the allergen.

主权项

1. A diagnostic kit for performing in vitro diagnosis of type 1 allergy, comprising a horse allergen immobilized on a solid support, wherein the horse allergen has a molecular weight of 15 kDa under non-reducing conditions and comprises a first peptide chain having a molecular weight of 5 kDa under reducing conditions and a second peptide chain having a molecular weight of 10 kDa under reducing conditions, the molecular weights measured under denaturing conditions using SDS-PGE, wherein the first peptide segment and the second peptide segment are linked together, and wherein the first peptide segment comprises the amino acid sequence ATCPAVATDIASFFLLPDSLFKLQLIKYQAPPEAKDATMQVKQCINEISAGDRYIITETLGKIVLQCGA (SEQ ID NO: 4) and the second peptide segment comprises the amino acid sequence GSGCQLLEDVVEKTITAELSPAEYVEAVQEFIPDEATEKAAIQLKQCYLKQSNETLNDFRTMMNSMYNSAYCALF (SEQ ID NO: 5).