| 摘要 |
The present invention concerns a portion of a conformational epitope of human immunodeficiency virus envelope gp120 comprising the sequence EDIISLWDQSLKPCVKLTPLCVSLKCTDLK 113 142 of the BH-10 subtype, not comprising more than 302 amino acids, and analogous sequences from human immunodeficiency virus gp120 isolates other than BH-10. Such sequence can be employed in an anti-HIV-1 vaccine. The sequence can also be used in combination with amino acid sequences from (303-338) of the BH subtype of HIV-1, or analogous sequences from HIV-1 isolates other than BH-10.
|
