| 摘要 |
Patent No. 602702 Disclosed is a modified FGF-21 polypeptide that maintains a biological activity of an unmodified human FGF-21 polypeptide, wherein said modified FGF-21 polypeptide comprises an amino acid sequence that: (i) is between 85% identical and 90% identical to a sequence set forth in HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS; and (ii) comprises at least one non-naturally encoded amino acid each of which is at a position corresponding to residue 72, 77, 86, 87, 91, 104, 108, 110, 126, 131, or 146 of HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS. |
