| 摘要 |
This invention concerns DC-SIGN binding peptides or proteins and uses thereof in modulating immune responses and in treating immune disorders. Accordingly, one aspect of this invention features an isolated protein containing a first polypeptide chain that has the sequence of VWDVSHEDPHEVKFNWYVDGVEVHNAKTKPREQQYNSTY (SEQ ID NO: 1). The first polypeptide chain can be about 40 to about 230 (e.g., 40-220, 40-200, 40-180, 15 40-150, 40-100, 40-80, 40-70, 40-60, 40-50, and 40-45, inclusive) amino acid residues (aa.) in length. The just mentioned sequence corresponds to aa. 261-300 of human lgG1 Fe. The first polypeptide chain can include additional fragment sequences from the human lgG1 Fe, but optionally is not the full-length human IgGI Fe. |
