| 摘要 |
Provided is a molecular probe for pancreatic islet imaging. The molecular probe includes a polypeptide represented by formula (1) or a polypeptide having homology with said polypeptide. Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2 (1) (Sequence No. 1) In formula (1), [X] is a lysine residue in which the side-chain amino groups are labeled by groups represented by formula (I). (I) In formula (I): A is an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 is a substituent group containing 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I or 131I; R2 is a hydrogen atom or a substituent group different from R1; and R3 is any of a bond, a C1-C6 alkylene group, or a C1-C6 oxyalkylene group. |
