Polypeptides for inducing a protective immune response against Staphylococcus aureus

摘要

The present invention features polypeptides comprising an amino acid sequence structurally related to SEQ ID NO: 1 or a fragment thereof, S. aureus AhpC-AhpF compositions, and uses of such polypeptides and compositions. SEQ ID NO: 1 has a full length S. aureus AhpC sequence. A derivative of SEQ ID NO: 1 containing an amino His-tag and three additional carboxyl amino acids was found to produce a protective immune response against S. aureus. MGHHHHHHHHHHSSGHIEGRHMSLINKEILPFTAQAFDPKKDQFKEVTQE DLKGSWSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHF VHKAWHDHSDAISKITYTMIGDPSQTITRNDVLDEATGLAQRGTFIIDPD GVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ PGLDLVGKIAEQ