摘要 |
Methods are provided for discovery of new lead pharmaceuticals useful for addressing diseases and other problems of hearing. Compounds that modulate PSD-95 induction are discovered via use of the Nrg-1/Eos signaling pathway. Cell based assay systems are particularly described that identify modulation of binding of Nrg-ICD with an Eos binding site. Other features include the promotion and/or inhibition of Nrg-ICD translocation across nuclear membranes. <tables id="TABLE-US-00001" num="1"> <table frame="none" colsep="0" rowsep="0" tabstyle="monospace"> <tgroup align="left" colsep="0" rowsep="0" cols="2"> <colspec colname="1" colwidth="217PT" align="left"/> <colspec colname="2" colwidth="0PT" align="left"/> <TBODY VALIGN="TOP"> <ROW> <ENTRY/> </ROW> <ROW> <ENTRY>Human Nrg-ICD Polypeptide Sequence</ENTRY> <ENTRY/> </ROW> </TBODY> </TGROUP> <tgroup align="left" colsep="0" rowsep="0" cols="2"> <colspec colname="1" colwidth="217PT" align="right"/> <colspec colname="2" colwidth="0PT" align="left"/> <TBODY VALIGN="TOP"> <ROW> <ENTRY>SEQ ID NO: 1</ENTRY> <ENTRY/> </ROW> </TBODY> </TGROUP> <tgroup align="left" colsep="0" rowsep="0" cols="2"> <colspec colname="1" colwidth="217PT" align="left"/> <colspec colname="2" colwidth="0PT" align="left"/> <TBODY VALIGN="TOP"> <ROW> <ENTRY>KTKKQRKKLHDRLRQSLRSERNNVMNMANGPHHPNPPPDNVQLVNQYVSK</ENTRY> <ENTRY/> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>NIISSERVVERETETSFSTSHYTSTTHHSMTVTQTPSHSWSNGHTESILS</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>ESHSVLVSSSVENSRHTSPTGPRGRLNGIGGPREGNSFLRHARETPDSYR</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>DSPHSERYVSAMTTPARMSPVDFHTPTSPKSPPSEMSPPVSSLTISIPSV</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>AVSPFMDEERPLLLVTPPRLREKYDNHLQQFNSFHNNPTHESNSLPPSPL</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>RIVEDEEYETTQEYEPAQEPPKKLTNSRRVKRTKPNGHISSRVEVDSDTS</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>SQSTSSESETEDERTGEDTPFLSIQNPMATSLEPAAAYRLAENRTNPANR</ENTRY> </ROW> <ROW> <ENTRY> </ENTRY> </ROW> <ROW> <ENTRY>FSTPEELQARLSSVIANQDPIAV</ENTRY> </ROW> </TBODY> </TGROUP> </TABLE> </TABLES>
|