Neuregulin protein regulation of synaptic proteins

摘要

Methods are provided for discovery of new lead pharmaceuticals useful for addressing diseases and other problems of hearing. Compounds that modulate PSD-95 induction are discovered via use of the Nrg-1/Eos signaling pathway. Cell based assay systems are particularly described that identify modulation of binding of Nrg-ICD with an Eos binding site. Other features include the promotion and/or inhibition of Nrg-ICD translocation across nuclear membranes. Human Nrg-ICD Polypeptide Sequence SEQ ID NO: 1 KTKKQRKKLHDRLRQSLRSERNNVMNMANGPHHPNPPPDNVQLVNQYVSK NIISSERVVERETETSFSTSHYTSTTHHSMTVTQTPSHSWSNGHTESILS ESHSVLVSSSVENSRHTSPTGPRGRLNGIGGPREGNSFLRHARETPDSYR DSPHSERYVSAMTTPARMSPVDFHTPTSPKSPPSEMSPPVSSLTISIPSV AVSPFMDEERPLLLVTPPRLREKYDNHLQQFNSFHNNPTHESNSLPPSPL RIVEDEEYETTQEYEPAQEPPKKLTNSRRVKRTKPNGHISSRVEVDSDTS SQSTSSESETEDERTGEDTPFLSIQNPMATSLEPAAAYRLAENRTNPANR FSTPEELQARLSSVIANQDPIAV