| 摘要 |
<p>A 78 residue polypeptide comprising the following amino acid sequence: GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE and functional derivatives and pharmaceutically acceptable salts thereof, said sequence comprising intra-linked half-cysteines; pharmaceutical composition containing such polypeptide as an active ingredient; a method for inhibiting microbial growth and cancer cell growth in animals including man; and nucleotide sequence corresponding to such polypeptide.</p> |
