| 摘要 |
PCT No. PCT/SE95/00475 Sec. 371 Date Dec. 4, 1996 Sec. 102(e) Date Dec. 4, 1996 PCT Filed Apr. 28, 1995 PCT Pub. No. WO95/29937 PCT Pub. Date Nov. 9, 1995A 78 residue polypeptide comprising the following amino acid sequence GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKK PQAICVDIKICKE [SEQ ID NO:1]:and functional derivatives and pharmaceutically acceptable salts thereof, said sequence comprising intra-linked half-cysteines; pharmaceutical composition containing such polypeptide as an active ingredient; a method for inhibiting microbial growth and cancer cell growth in animals including man; and nucleotide sequence corresponding to such polypeptide. |
