| 摘要 |
Disclosed is a novel polypeptide whose N-terminus is EAQ and which is composed of 60 amino acids. The polypeptide is produced from human breast cancer cell MCF7, or human gastric cancer cell MKN-45 or KATO-III, which polypeptide has a isoelectric point of 4.3, a molecular weight of 6,661 and the following amino acid sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANK +TR GCCFDDTVRGVPWCFYPNTIDVPPEEECEF.
|
