摘要 |
Discloses a peptide attached to one or more nucleic acid molecules capable of being internalized into a cell, wherein the peptide molecule a) has a the sequence IREIMEKFGKQPVSLPARRLKLRGRKRRQR (SEQ ID NO: 3); which is internalized into a cell with an efficacy being at least 200% of the internalization efficacy of the TAT peptide having the amino acid sequence GRKKRRQRRRPPQ (SEQ ID NO: 1) and wherein the attachment is accomplished by a linkage selected from the group consisting of a covalent linkage and a non-covalent linkage. |