Angiogenesis inhibitors, compositions containing same and use thereof for treating diseases related to angiogenetic deregulation

摘要

A peptide molecule that interferes with an HLH domain of TAL-1 including at least 10 successive amino acids from the HLH domain of TAL-1 of sequence: QQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLA (SEQ ID No. 1) or an equivalent sequence; and a pharmaceutical composition comprising at least one peptide molecule as an active ingredient, and an acceptable vehicle.