| 摘要 |
Production of halogenated benzamides is effected by enzymatic hydrolysis of halogenated benzonitriles using a Brevibacterium nitrile hydratase defined as being a tetrameric enzyme of structure alpha 2 beta 2 having at least 50%, preferably more than 80%, homology with the amino acid sequences of the alpha chain and the beta chain. MSVTIDHTTENAAPAQAPVSDRAWALFRA LDGKGLVPDGYVEGWKKTFEEDFSPRRGA ELVARAWTDPEFRQLLLTDGTAAVAQYGY LGPQGEYIVAVEDTPTLKNVIVCSLCSCTA WPILGLPPTWYKSFEYRARVVREPRKVLSE MGTEIASDIEIRVYDTTAETRYMVLPQRPAG TEGWSQEQLQEIVTKDCLIGVAIPQVPTV ( alpha chain). MDGVHDLAGVQGFGKVPHTVNADIGPTFH AEWEHLPYSLMFAGVAELGAFSVDEVRYV VERMEPRHYMMTPYYERYVIGVATLMVEK GILTQDELESLAGGPFPLSRPSESEGRPAPVE TTTFEVGQRVRVRDEYVPGHIRMPAYCRGR VGTISHRTTEKWPFPDAIGHGRNDAGEEPTY VKFAAEELFGSDTDGGSVVVDLFEGYLEPAA ( beta chain). Also CLAIMED are: (1) the benzamide produced by the above method; and (2) 2,6-difluorobenzamide obtained by the hydrolysis of 2,6-difluorobenzonitrile, using the above method. |
