摘要 |
<p>A consensus peptide of 36 amino acids has been designed which acts as an immunogen raising antibodies against the proteins of all members of the E.coli family CS4-CFA/1. While the N-terminus of members of this family of organisms shows a high degree of identity, the remainder of the sequence of the proteins shows much less homology across the strains. The region of the protein represented in the subunit encompasses known linear B- and T-cell epitopes of CFA/I. The consensus peptide has a high level of homology to strains bearing six different colonization factors. The consensus peptide is of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. An alternative peptide, identified as consensus peptide 2 is of the formula: VEKNITVTASVDPTIDLLQADGSALPASVALTYSPA.</p> |