| 摘要 |
Provided are: Peptides, diagnostic antigens containing said peptides, antibodies against said peptides, a method of antibody purification, immunoassay methods, a vaccine composition containing said peptides and medicaments containing said peptides or antibodies against said peptides. The vaccine can protect humans and animals against infection caused by influenza A, B and C viruses. The immunoassay methods permit detection of influenza virus particles or viral antigens or antibodies to these antigens or disease caused by influenza viruses A, B and C. The medicaments can inhibit the reproduction of influenza viruses in infected humans and animals and modulate the course of influenza virus infection. The peptides are selected from the 7th segment of influenza A and B and the 6th segment of influenza C: (Influenza A virus) X-PHXLXXXFRRRPSFXTVFKXXXXXFEXKXIKNPQYXVQXXNDXXXXXXRXT-Z; (Influenza B virus) X-KKQIEAPISAFCISVRHLLFFIHSKAESRSNSFPPNQQCNFSASSALPSPSSV(23)ESR-Z; (Influenza C virus) X-PDIRGRCSFLISLAADLQADFPPVIAEIIAVLVSGATFFRNASVSAISISCAIV-Z (Influenza C virus) X-ISPHHLSHLPSTKPLTSSIMIFTNKYNIVIIPNPKEANVSMYPWVSLKQ-Z; and shorter variants thereof with at least 7 amino acids. |
