PEPTIDES AND BINDING PARTNERS THEREFOR

摘要

The invention provides a peptide obtainable from C. albicans as well as variants and fragments thereof, and labelled forms of these. The peptide is immunogenic and specific binding partners for the peptide and labelled forms of these specific binding partners form a further aspect of the invention. The peptide is a fragment of the ECE1 protein and has been found to be both immunogenic and act as a pore-forming toxin. A range of therapeutic and diagnostic applications for the peptide and the specific binding partners for it form further aspects of the invention. In addition, the peptide may be used in screens for identifying compounds having useful anti-fungal activity.

主权项

1. A peptide which is of SEQ ID NO 1(SEQ ID NO 1)SIIGIIMGILGNIPQVIQIIMSIVKAFKGNKR or a variant thereof, wherein the variant is an orthologue of the peptide of SEQ ID NO 1 or a peptide which is at least 70% identical to SEQ ID NO 1; or a fragment of either of these; or a labelled form thereof.