| 摘要 |
Antibodies raised against recombinant or synthetic cpn10 are disclosed. The cpn10 has the sequence GSMAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQ ATVEAVGSGSKGKGGEIQPVSVKEGDKVLLPEYGGTKVVLDDKDYFLFRDGDIL GKYVD (SEQ ID NO: 21 ). Antibodies are raised against either the entire sequence of cpn 10, or a shorter peptide sequence derived from cpn 10, such as Ac-AGQAFRKFLPL (SEQ ID NO: 2 ), ACQAFRKFLPL (SEQ ID NO 1 ), or EKSQGKVLQAT (SEQ ID NO: 3 ), in which the peptides may have a single amino acid deletion, addition or substitution. The antibodies can be used to terminate pregnancy, suppress tumor cell growth or enhance the immune system. |
